PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023744m
Common NameCARUB_v10023744mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 298aa    MW: 33896.2 Da    PI: 8.0184
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023744mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.51e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+d++++ G+g +W + +++ g++R++k+c++rw++yl
  Carubv10023744m 14 RGPWSPEEDAKLKDYIEKQGTGgNWIALPHKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding42.91.2e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd +++ +++  G++ W+ Ia+++  gRt++++k++w++
  Carubv10023744m  69 GDFTEEEDNIIYSLFASIGSR-WSVIAAHLH-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.148962IPR017930Myb domain
SuperFamilySSF466894.79E-2711109IPR009057Homeodomain-like
SMARTSM007172.6E-111364IPR001005SANT/Myb domain
PfamPF002492.1E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-231569IPR009057Homeodomain-like
CDDcd001677.46E-81662No hitNo description
PROSITE profilePS5129422.00663117IPR017930Myb domain
SMARTSM007173.3E-1267115IPR001005SANT/Myb domain
PfamPF002499.1E-1369111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-2470118IPR009057Homeodomain-like
CDDcd001676.07E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009785Biological Processblue light signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDAKLKDYIE KQGTGGNWIA LPHKAGLRRC GKSCRLRWLN  60
YLRPNIRHGD FTEEEDNIIY SLFASIGSRW SVIAAHLHGR TDNDIKNYWN TKLKKKLIAT  120
MAPPPHHHLA IGTSISPPPS SSSHYNMINS LHPYNPSIST NQPLTPHQGM MMTMMGQQQQ  180
LLYQEDMGSL VNSPNRNKLI MSHQEDSHEQ STNKGIMLLS DVRSGSSKTS TVTRVKMEHR  240
DHHHHHHEED ERSMSSVVIE DYGMEEIKQL IGSSCTSSSN SLWFDENKTE DKFMLYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195770.0AY519577.1 Arabidopsis thaliana MYB transcription factor (At2g36890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294706.10.0hypothetical protein CARUB_v10023744mg
SwissprotQ9SJL71e-159RAX2_ARATH; Transcription factor RAX2
TrEMBLR0HDJ30.0R0HDJ3_9BRAS; Uncharacterized protein
STRINGAT2G36890.11e-157(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.11e-157MYB family protein